Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Arabidopsis thaliana
Western blot analysis of extracts of various tissues from Arabidopsis thaliana, using PIF4 Rabbit pAb (A20725) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
| Product name | PIF4 Rabbit pAb |
|---|---|
| Catalog No. | A20725 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of arabidopsis thaliana PIF4 (NP_565991.2). |
|---|---|
| Sequence | IDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPME |
| Gene ID | |
| Swiss Prot | |
| Synonyms | AtPIF4; MFL8.13; MFL8_13; phytochrome interacting factor 4; SRL2; PIF4 |
| Calculated MW | 48kDa |
| Observed MW | 55kDa |
| Reactivity | Arabidopsis thaliana |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | seedling, rosette leaf |
| Cellular location | nucleus. |
| Customer validation | WB(Arabidopsis thaliana) RT-qPCR(Arabidopsis thaliana) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20725? Please let us know so that we can cite the reference in this datasheet.
