제품 > 항체 > 단일클론항체(mAb)

PIM2 Rabbit mAb (A9230)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using PIM2 Rabbit mAb (A9230) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunoprecipitation - PIM2 Rabbit mAb (A9230)

Immunoprecipitation analysis of 300 μg extracts of Raji cells using 3 μg PIM2 antibody (A9230). Western blot was performed from the immunoprecipitate using PIM2 antibody (A9230) at a dilution of 1:1000.

Overview

Product name	PIM2 Rabbit mAb
Catalog No.	A9230
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2497

Background

This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 10-120 of human PIM2 (NP_006866.2).
Sequence	PAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
Gene ID
Swiss Prot
Synonyms	PIM2; serine/threonine-protein kinase pim-2
Calculated MW	34kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Raji, Mouse brain, Mouse spleen, Mouse thymus, Rat brain
Cellular location	cytoplasm
Customer validation	WB(Homo sapiens, Mus musculus)