Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | PIST/GOPC Rabbit pAb |
---|---|
Catalog No. | A13436 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 195-454 of human PIST/PIST/GOPC (NP_001017408.1). |
---|---|
Sequence | ARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY |
Gene ID | |
Swiss Prot | |
Synonyms | CAL; FIG; PIST; GOPC1; dJ94G16.2 |
Calculated MW | 51kDa |
Observed MW | 51kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | THP-1, Mouse kidney, Mouse brain |
Cellular location | Cell junction, Cell projection, Cytoplasm, Golgi apparatus, Golgi apparatus membrane, Peripheral membrane protein, dendrite, postsynaptic cell membrane, postsynaptic density, synapse, trans-Golgi network membrane |
Customer validation | WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13436? Please let us know so that we can cite the reference in this datasheet.