제품 > 항체 > 단일클론항체(mAb)

PIST/GOPC Rabbit mAb (A0582)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PIST/GOPC Rabbit mAb (A0582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from Mouse lung, using PIST/GOPC Rabbit mAb (A0582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - PIST/GOPC Rabbit mAb (A0582)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PIST/GOPC Rabbit mAb (A0582) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PIST/GOPC Rabbit mAb (A0582)

Immunofluorescence analysis of C6 cells using PIST/GOPC Rabbit mAb (A0582) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using PIST/GOPC Rabbit mAb (A0582) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PIST/GOPC Rabbit mAb
Catalog No.	A0582
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1831

Background

This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26).
Sequence	MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVD
Gene ID
Swiss Prot
Synonyms	CAL; FIG; PIST; GOPC1; dJ94G16.2; PIST/GOPC
Calculated MW	51kDa
Observed MW	59kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, U-87MG, Rat brain, Mouse lung
Cellular location	Cell junction, Cell projection, Cytoplasm, Golgi apparatus, Golgi apparatus membrane, Peripheral membrane protein, dendrite, postsynaptic cell membrane, postsynaptic density, synapse, trans-Golgi network membrane