제품 > 항체 > 단일클론항체(mAb)

PITRM1 Rabbit mAb (A24652)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from mouse placenta, using PITRM1 Rabbit mAb (A24652) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PITRM1 Rabbit mAb (A24652)

Immunohistochemistry analysis of PITRM1 in paraffin-embedded human colon carcinoma using PITRM1 Rabbit mAb (A24652) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of PITRM1 in paraffin-embedded human kidney using PITRM1 Rabbit mAb (A24652) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of PITRM1 in paraffin-embedded human liver using PITRM1 Rabbit mAb (A24652) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PITRM1 Rabbit mAb (A24652)

Confocal imaging of A-431 cells using PITRM1 Rabbit mAb (A24652, at dilution of 1:200) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 1000x.

Overview

Product name	PITRM1 Rabbit mAb
Catalog No.	A24652
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63553

Background

The protein encoded by this gene is an ATP-dependent metalloprotease that degrades post-cleavage mitochondrial transit peptides. The encoded protein binds zinc and can also degrade amyloid beta A4 protein, suggesting a possible role in Alzheimer's disease.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 758-1037 of human PITRM1 (NP_055704.2).
Sequence	IKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPENPKIAKDPSWIIQ
Gene ID
Swiss Prot
Synonyms	MP1; PreP; SCAR30; PITRM1
Calculated MW	117kDa
Observed MW	117kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse placenta
Cellular location	Mitochondrion matrix