Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | PIWIL1 Rabbit mAb |
---|---|
Catalog No. | A3490 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0786 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PIWIL1 (Q96J94). |
---|---|
Sequence | YRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN |
Gene ID | |
Swiss Prot | |
Synonyms | HIWI; MIWI; PIWI; CT80.1; PIWIL1 |
Calculated MW | 99kDa |
Observed MW | 90kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse testis, Mouse brain, Rat testis, Rat brain |
Cellular location | Cytoplasm |
Customer validation | IF(Mus musculus) WB(Mus musculus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3490? Please let us know so that we can cite the reference in this datasheet.