제품 > 항체 > 다중클론항체(pAb)

PIWIL2 Rabbit pAb (A3073)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of Mouse testis, using PIWIL2 Rabbit pAb (A3073) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	PIWIL2 Rabbit pAb
Catalog No.	A3073
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PIWIL2 (Q8TC59).
Sequence	LGRGLSANLVRKDREELSPTFWDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRGPPQLSSPPALPQSPLHSPDR
Gene ID
Swiss Prot
Synonyms	CT80; HILI; mili; PIWIL1L
Calculated MW	110kDa
Observed MW	110kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse testis
Cellular location	Cytoplasm