Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using PIWIL4 Rabbit pAb (A13201) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Mouse testis using PIWIL4 Rabbit pAb (A13201) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | PIWIL4 Rabbit pAb |
|---|---|
| Catalog No. | A13201 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human PIWIL4 (NP_689644.2). |
|---|---|
| Sequence | SADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHI |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HIWI2; MIWI2; PIWIL4 |
| Calculated MW | 97kDa |
| Observed MW | 97kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | Mouse testis, Mouse lung, Rat testis, Rat liver |
| Cellular location | Cytoplasm, Nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
