제품 > 항체 > 단일클론항체(mAb)

PJVK Rabbit mAb (A23724)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with PJVK, using PJVK Rabbit mAb (A23724) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS

Overview

Product name	PJVK Rabbit mAb
Catalog No.	A23724
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61181

Background

The protein encoded by this gene is a member of the gasdermin family, a family which is found only in vertebrates. The encoded protein is required for the proper function of auditory pathway neurons. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal recessive type 59 (DFNB59).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 290-352 of human PJVK（NP_001036167.1）.
Sequence	KEGTHIRVNLLNHNIPKGPCILCGMGNFKRETVYGCFQCSVDGQKYVRLHAVPCFDIWHKRMK
Gene ID
Swiss Prot
Synonyms	DFNB59; PJVK
Calculated MW	40kDa
Observed MW	45kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T-PJVK
Cellular location	Peroxisome membrane, cilia.