Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PKACα Rabbit pAb |
---|---|
Catalog No. | A24483 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKACα (NP_002721.1). |
---|---|
Sequence | IVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF |
Gene ID | |
Swiss Prot | |
Synonyms | PRKACA; PKACA; PPNAD4; cAMP-dependent protein kinase catalytic subunit alpha; PKACα |
Calculated MW | 39kDa/40kDa |
Observed MW | 41kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, NIH/3T3, Rat heart |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Lipid-anchor, Membrane, Mitochondrion, Nucleus, cilium, flagellum |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.