제품 > 항체 > 다중클론항체(pAb)

PKA C-beta (PRKACB) Rabbit pAb (A5324)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Rat spleen, using PKA C-beta (PRKACB) Rabbit pAb (A5324) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - PKA C-beta (PRKACB) Rabbit pAb (A5324)

Immunohistochemistry analysis of paraffin-embedded Rat brain using PKA C-beta (PRKACB) Rabbit pAb (A5324) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human appendix using PKA C-beta (PRKACB) Rabbit pAb (A5324) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PKA C-beta (PRKACB) Rabbit pAb (A5324)

Immunofluorescence analysis of NIH-3T3 cells using PKA C-beta (PRKACB) Rabbit pAb (A5324) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using PKA C-beta (PRKACB) Rabbit pAb (A5324) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of MCF7 cells using PKA C-beta (PRKACB) Rabbit pAb (A5324) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using PKA C-beta (PRKACB) Rabbit pAb (A5324) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PKA C-beta (PRKACB) Rabbit pAb
Catalog No.	A5324
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the serine/threonine protein kinase family. The encoded protein is a catalytic subunit of cAMP (cyclic AMP)-dependent protein kinase, which mediates signalling though cAMP. cAMP signaling is important to a number of processes, including cell proliferaton and differentiation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-351 of human PKA C-beta (PRKACB) (NP_002722.1).
Sequence	KIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
Gene ID
Swiss Prot
Synonyms	CAFD2; PKACB; PKA C-beta; PKA C-beta (PRKACB)
Calculated MW	41kDa
Observed MW	46kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Rat spleen
Cellular location	Cell membrane, Cytoplasm, Lipid-anchor, Membrane, Nucleus
Customer validation	WB(Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus)