Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | PKC gamma Rabbit mAb |
---|---|
Catalog No. | A9565 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1637 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 604-697 of human PKC gamma (P05129). |
---|---|
Sequence | GEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM |
Gene ID | |
Swiss Prot | |
Synonyms | PKCC; PKCG; SCA14; PKCI(3); PKCgamma; PKC-gamma |
Calculated MW | 78kDa |
Observed MW | 78kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cell junction, Cell membrane, Cell projection, Cytoplasm, Peripheral membrane protein, dendrite, perinuclear region, synapse, synaptosome |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9565? Please let us know so that we can cite the reference in this datasheet.