제품 > 항체 > 단일클론항체(mAb)

PKC mu Rabbit mAb (A2417)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PKC mu Rabbit mAb (A2417) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Overview

Product name	PKC mu Rabbit mAb
Catalog No.	A2417
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1919

Background

The protein encoded by this gene is a serine/threonine protein kinase involved in many cellular processes, including Golgi body membrane integrity and transport, cell migration and differentiation, MAPK8/JNK1 and Ras pathway signaling, MAPK1/3 (ERK1/2) pathway signaling, cell survival, and regulation of cell shape and adhesion.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PKC mu (Q15139).
Sequence	RRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
Gene ID
Swiss Prot
Synonyms	PKD; PKCM; CHDED; PRKCM; PKC-MU; PKC mu
Calculated MW	102kDa
Observed MW	102kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HT-29, U-87MG, Mouse lung, Mouse testis, Mouse kidney, Rat lung, Rat testis, Rat kidney
Cellular location	Cell membrane, Cytoplasm, Golgi apparatus, trans-Golgi network
Customer validation	WB(Homo sapiens, Mus musculus, Rattus norvegicus)