Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | PKC zeta Rabbit mAb |
---|---|
Catalog No. | A23777 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC61755 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PKC zeta. (NP_002735.3). |
---|---|
Sequence | MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTP |
Gene ID | |
Swiss Prot | |
Synonyms | PRKCZ; PKC-ZETA; PKC2; protein kinase C zeta; PKC zeta |
Calculated MW | 46kDa/56kDa/67kDa |
Observed MW | 75kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, Hep G2 |
Cellular location | Cell junction, Cytoplasm, Endosome |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.