제품 > 항체 > 다중클론항체(pAb)

PLA2G4D Rabbit pAb (A15224)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunofluorescence analysis of Hela cells using PLA2G4D Rabbit pAb (A15224) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PLA2G4D Rabbit pAb
Catalog No.	A15224
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The phospholipase A2 enzyme family, including PLA2G4D, catalyze the hydrolysis of glycerophospholipids at the sn-2 position and then liberate free fatty acids and lysophospholipids (Chiba et al., 2004 [PubMed 14709560]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 510-680 of human PLA2G4D (NP_828848.3).
Sequence	RLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPF
Gene ID
Swiss Prot
Synonyms	cPLA2delta; PLA2G4D
Calculated MW	92kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle membrane, Peripheral membrane protein, cytosol