제품 > 항체 > 단일클론항체(mAb)

PLC gamma 2 (PLCG2) Rabbit mAb (A5182)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Raji cells, using PLC gamma 2 (PLC gamma 2 (PLCG2)) Rabbit mAb (A5182) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - PLC gamma 2 (PLCG2) Rabbit mAb (A5182)

Immunofluorescence analysis of Raw 264 7 cells using PLC gamma 2 (PLC gamma 2 (PLCG2)) Rabbit mAb (A5182) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of THP-1 cells using PLC gamma 2 (PLC gamma 2 (PLCG2)) Rabbit mAb (A5182) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded rat spleen using PLC gamma 2 (PLC gamma 2 (PLCG2)) Rabbit mAb (A5182) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PLC gamma 2 (PLCG2) Rabbit mAb
Catalog No.	A5182
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1176

Background

The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4, 5-bisphosphate to 1D-myo-inositol 1, 4, 5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 2 (PLC gamma 2 (PLCG2)) (P16885).
Sequence	RHFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYKAKRSDELSFCRGALIHNVS
Gene ID
Swiss Prot
Synonyms	FCAS3; APLAID; PLC-IV; PLC-gamma-2; PLC gamma 2 (PLCG2)
Calculated MW	148kDa
Observed MW	150kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Raji
Cellular location	cytoplasm, cytosol, extracellular exosome, perinuclear region of cytoplasm, plasma membrane, ruffle membrane