PLD1 Rabbit pAb (A24528)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

ABclonal:Immunofluorescence - PLD1 Rabbit pAb (A24528)

Immunofluorescence analysis of NIH/3T3 cells using PLD1 Rabbit pAb (A24528) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	PLD1 Rabbit pAb
Catalog No.	A24528
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene encodes a phosphatidylcholine-specific phospholipase which catalyzes the hydrolysis of phosphatidylcholine in order to yield phosphatidic acid and choline. The enzyme may play a role in signal transduction and subcellular trafficking. Alternative splicing results in multiple transcript variants with both catalytic and regulatory properties.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 940-1074 of human PLD1 (NP_002653.1).
Sequence	VMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Gene ID
Swiss Prot
Synonyms	PLD1; hPLD1; Phospholipase D1; Choline phosphatase 1; PLD 1; phospholipase D1
Calculated MW	68kDa/112kDa/119kDa/124kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Golgi apparatus membrane, Late endosome membrane, Lipid-anchor, perinuclear region