제품 > 항체 > 다중클론항체(pAb)

PLK2 Rabbit pAb (A7066)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PLK2 antibody (A7066) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - PLK2 Rabbit pAb (A7066)

Immunofluorescence analysis of NIH/3T3 cells using PLK2 Rabbit pAb (A7066) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using PLK2 Rabbit pAb (A7066) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	PLK2 Rabbit pAb
Catalog No.	A7066
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the polo family of serine/threonine protein kinases that have a role in normal cell division. This gene is most abundantly expressed in testis, spleen and fetal tissues, and its expression is inducible by serum, suggesting that it may also play an important role in cells undergoing rapid cell division. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 361-439 of human PLK2 (NP_006613.2).
Sequence	KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQ
Gene ID
Swiss Prot
Synonyms	SNK; hSNK; hPlk2
Calculated MW	78kDa
Observed MW	78kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549, HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain, Rat liver, Rat lung
Cellular location	Cell projection, Cytoplasm, centriole, centrosome, cytoskeleton, dendrite, microtubule organizing center
Customer validation	WB(Homo sapiens)