Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PLK2 Rabbit pAb |
---|---|
Catalog No. | A7066 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 361-439 of human PLK2 (NP_006613.2). |
---|---|
Sequence | KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQ |
Gene ID | |
Swiss Prot | |
Synonyms | SNK; hSNK; hPlk2 |
Calculated MW | 78kDa |
Observed MW | 78kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | A-549, HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain, Rat liver, Rat lung |
Cellular location | Cell projection, Cytoplasm, centriole, centrosome, cytoskeleton, dendrite, microtubule organizing center |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7066? Please let us know so that we can cite the reference in this datasheet.