Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | PLOD3 Rabbit mAb |
---|---|
Catalog No. | A22354 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC52018 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-306 of human PLOD3 (NP_001075.1). |
---|---|
Sequence | SDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQ |
Gene ID | |
Swiss Prot | |
Synonyms | LH3; PLOD3 |
Calculated MW | 85kDa |
Observed MW | 80kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | MCF7, BxPC-3, HepG2, Jurkat(Low expression control) |
Cellular location | Lumenal side, Peripheral membrane protein, Rough endoplasmic reticulum membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.