제품 > 항체 > 다중클론항체(pAb)

PML+RARA Rabbit pAb (A25051)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat

ABclonal:Immunofluorescence - PML+RARA Rabbit pAb (A25051)

Immunofluorescence analysis of C6 cells using Type L APL Rabbit pAb(A25051) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PML+RARA Rabbit pAb (A25051)

Immunofluorescence analysis of A-431 cells using Type L APL Rabbit pAb(A25051) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product namePML+RARA Rabbit pAb
Catalog No.A25051
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
Promyelocytic leukemia/retinoic acid receptor alpha or PML-RARA refers to an abnormal fusion gene sequence. It is a specific rearrangement of genetic material from two separate chromosomes (chromosomal translocation) and is associated with a specific type of leukemia.Promyelocytic leukemia (PML) is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Retinoic acid receptor alpha(RARA), regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia.
ImmunogenA synthetic peptide corresponding to a sequence within amino acids 500-600/1-100 of human PML+RARA(NP_150241.2/ NP_000955.1).
SequenceRLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHY
Gene ID
Swiss Prot
SynonymsPML/RARA; Type L APL
Calculated MW47-48kDa/62-97kDa/39kDa/50kDa
Observed MWRefer to figures
ReactivityHuman, Rat
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key applicationImmunofluorescence    
Positive samples
Cellular locationcytoplasm, cytosol, nuclear matrix, nuclear membrane, nucleolus, nucleoplasm, nucleus, PML body

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

    ABclonal:Immunofluorescence - PML+RARA Rabbit pAb (A25051)}

    Immunofluorescence - PML+RARA Rabbit pAb (A25051)

    Immunofluorescence analysis of C6 cells using Type L APL Rabbit pAb(A25051) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
    ABclonal:Immunofluorescence - PML+RARA Rabbit pAb (A25051)}

    Immunofluorescence - PML+RARA Rabbit pAb (A25051)

    Immunofluorescence analysis of A-431 cells using Type L APL Rabbit pAb(A25051) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

    * For research use only. Not for therapeutic or diagnostic purposes.

    항체 (2)

    Secondary Antibodies (26)