제품 > 항체 > 다중클론항체(pAb)

Type S APL Rabbit pAb (A25233)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human

ABclonal:Western blot - Type S APL Rabbit pAb (A25233)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Type S APL using Type S APL Rabbit pAb(A25233) at 1:1000 dilution. 
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 40.5 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product nameType S APL Rabbit pAb
Catalog No.A25233
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
Promyelocytic leukemia/retinoic acid receptor alpha or PML-RARA refers to an abnormal fusion gene sequence. It is a specific rearrangement of genetic material from two separate chromosomes (chromosomal translocation) and is associated with a specific type of leukemia.Promyelocytic leukemia (PML) is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Retinoic acid receptor alpha(RARA), regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia.
ImmunogenA synthetic peptide corresponding to a sequence within amino acids 388-487AA + 1-100AA of human Type S APL (NP_150241.2/ NP_000955.1).
SequenceSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRK MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHY
Gene ID
Swiss Prot
SynonymsPML/RARA; Type L APL
Calculated MW47-48kDa/62-97kDa/39kDa/50kDa
Observed MW100kDa
ReactivityHuman
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key applicationWestern blotting    
Positive samples293T transfected with Type S APL
Cellular locationcytoplasm, cytosol, nuclear matrix, nuclear membrane, nucleolus, nucleoplasm, nucleus, PML body

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

    ABclonal:Western blot - Type S APL Rabbit pAb (A25233)}

    Western blot - Type S APL Rabbit pAb (A25233)

    Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Type S APL using Type S APL Rabbit pAb(A25233) at 1:1000 dilution. 
    Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
    Lysates/proteins: 40.5 μg per lane.
    Blocking buffer: 3% nonfat dry milk in TBST.
    Detection: ECL Basic Kit (RM00020).
    Exposure time: 30s.

    * For research use only. Not for therapeutic or diagnostic purposes.

    항체 (2)

    Secondary Antibodies (26)