제품 > 항체 > 단일클론항체(mAb)

PMPCA Rabbit mAb (A24606)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using PMPCA Rabbit mAb (A24606) at 1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - PMPCA Rabbit mAb (A24606)

Immunohistochemistry analysis of PMPCA in paraffin-embedded human liver using PMPCA Rabbit mAb (A24606) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - PMPCA Rabbit mAb (A24606)

Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug PMPCA antibody (A24606 1:200). Western blot was performed from the immunoprecipitate using PMPCA antibody at a dilition of 1:2000.

Overview

Product name	PMPCA Rabbit mAb
Catalog No.	A24606
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63472

Background

The protein encoded by this gene is found in the mitochondrion, where it represents the alpha subunit of a proteolytic heterodimer. This heterodimer is responsible for cleaving the transit peptide from nuclear-encoded mitochondrial proteins. Defects in this gene are a cause of spinocerebellar ataxia, autosomal recessive 2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 291-525 of human PMPCA (NP_055975.1).
Sequence	AQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVDTVELERAKTQLTSMLMMNLESRPVIFEDVGRQVLATRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR
Gene ID
Swiss Prot
Synonyms	CLA1; CPD3; MAS2; P-55; SCAR2; INPP5E; Alpha-MPP; PMPCA
Calculated MW	55kDa
Observed MW	58kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:500 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, MCF7, Mouse placenta, Rat thymus
Cellular location	Mitochondrion matrix, Mitochondrion inner membrane