제품 > 항체 > 단일클론항체(mAb)

PNKP Rabbit mAb (A21145)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PNKP Rabbit mAb (A21145) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	PNKP Rabbit mAb
Catalog No.	A21145
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2974

Background

This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 400-500 of Human PNKP (NP_009185.2).
Sequence	GSWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILE
Gene ID
Swiss Prot
Synonyms	PNK; AOA4; MCSZ; CMT2B2; EIEE10; PNKP
Calculated MW	57kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SK-BR-3, Jurkat, U-937, Mouse spleen, Rat testis
Cellular location	Nucleus
Customer validation	WB(Homo sapiens)