제품 > 항체 > 단일클론항체(mAb)

PODXL Rabbit mAb (A4554)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using PODXL Rabbit mAb (A4554) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - PODXL Rabbit mAb (A4554)

Immunohistochemistry analysis of paraffin-embedded Human kidney cancer using PODXL Rabbit mAb (A4554) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	PODXL Rabbit mAb
Catalog No.	A4554
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1031

Background

This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-479 of human PODXL (O00592).
Sequence	SPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAAL
Gene ID
Swiss Prot
Synonyms	PC; PDX; PCLP; Gp200; gp135; PCLP-1; PODXL1; PODXL
Calculated MW	59kDa
Observed MW	200-400kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HCT 116, 293T, U-251MG
Cellular location	apical plasma membrane, cytoplasm, extracellular exosome, extracellular space, microvillus membrane, nucleolus, plasma membrane, slit diaphragm
Customer validation	WB(Homo sapiens)