제품 > 항체 > 다중클론항체(pAb)

POLE4 Rabbit pAb (A24516)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:House, Mouse

Western blot analysis of lysates from Mouse liver, using POLE4 Rabbit pAb (A24516) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	POLE4 Rabbit pAb
Catalog No.	A24516
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLE4 (NP_063949.2).
Sequence	MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLD
Gene ID
Swiss Prot
Synonyms	POLE4; YHHQ1; p12; DNA polymerase epsilon subunit 4
Calculated MW	12kDa
Observed MW	15kDa

Applications

Reactivity	House, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver
Cellular location	Nucleus