제품 > 항체 > 다중클론항체(pAb)

POLR2D Rabbit pAb (A1859)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using POLR2D Rabbit pAb (A1859) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - POLR2D Rabbit pAb (A1859)

Immunofluorescence analysis of A549 cells using POLR2D Rabbit pAb (A1859).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

ABclonal:Immunoprecipitation - POLR2D Rabbit pAb (A1859)

Immunoprecipitation analysis of 200 μg extracts of HepG2 cells using 1 μg POLR2D antibody (A1859). Western blot was performed from the immunoprecipitate using POLR2D antibody (A1859) at a dilution of 1:1000.

Overview

Product name	POLR2D Rabbit pAb
Catalog No.	A1859
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human POLR2D (NP_004796.1).
Sequence	MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Gene ID
Swiss Prot
Synonyms	RBP4; RPB4; RPB16; HSRBP4; HSRPB4; POLR2D
Calculated MW	16kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:10 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	MCF-7, SW480, SW620, HepG2, SK-HEPC, Mouse spleen
Cellular location	Nucleus
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

POLR2D Rabbit pAb images

Western blot - POLR2D Rabbit pAb (A1859)

Immunofluorescence - POLR2D Rabbit pAb (A1859)

Immunofluorescence analysis of A549 cells using POLR2D Rabbit pAb (A1859).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Immunoprecipitation - POLR2D Rabbit pAb (A1859)

* For research use only. Not for therapeutic or diagnostic purposes.