제품 > 항체 > 다중클론항체(pAb)

POLR2E Rabbit pAb (A1755)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using POLR2E Rabbit pAb (A1755) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - POLR2E Rabbit pAb (A1755)

Immunohistochemistry analysis of POLR2E in paraffin-embedded rat brain tissue using POLR2E Rabbit pAb (A1755) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of POLR2E in paraffin-embedded human brain tissue using POLR2E Rabbit pAb (A1755) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of POLR2E in paraffin-embedded mouse lung tissue using POLR2E Rabbit pAb (A1755) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - POLR2E Rabbit pAb (A1755)

Immunofluorescence analysis of A549 cells using POLR2E Rabbit pAb (A1755).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Overview

Product name	POLR2E Rabbit pAb
Catalog No.	A1755
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human POLR2E (NP_002686.2).
Sequence	MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Gene ID
Swiss Prot
Synonyms	RPB5; XAP4; RPABC1; hRPB25; hsRPB5; POLR2E
Calculated MW	25kDa
Observed MW	26kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, U-937, SW620, Raji, Jurkat, SKOV3
Cellular location	Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

POLR2E Rabbit pAb images

Western blot - POLR2E Rabbit pAb (A1755)

Immunohistochemistry - POLR2E Rabbit pAb (A1755)

Immunofluorescence - POLR2E Rabbit pAb (A1755)

Immunofluorescence analysis of A549 cells using POLR2E Rabbit pAb (A1755).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.