Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | PORCN Rabbit pAb |
---|---|
Catalog No. | A12120 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1). |
---|---|
Sequence | PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG |
Gene ID | |
Swiss Prot | |
Synonyms | PPN; DHOF; FODH; MG61; PORC; PORCN |
Calculated MW | 52kDa |
Observed MW | 60kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, HepG2 |
Cellular location | Endoplasmic reticulum membrane, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.