Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Product name | PP2A-Aβ/PR65β/PPP2R1B Rabbit pAb |
---|---|
Catalog No. | A24836 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 502-601 of human PP2A-Aβ/PR65β/PPP2R1B(NP_002707.3). |
---|---|
Sequence | ANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA |
Gene ID | |
Swiss Prot | |
Synonyms | PPP2R1B; PP2A-Abeta; PR65B; protein phosphatase 2 scaffold subunit Abeta; PP2A-Aβ/PR65β/PPP2R1B |
Calculated MW | 52kDa/61kDa/66kDa/73kDa |
Observed MW | 66kDa |
Reactivity | Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat spleen |
Cellular location | Cytoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.