Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | PPARα Rabbit pAb |
---|---|
Catalog No. | A6697 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human PPARα (NP_005027.2). |
---|---|
Sequence | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDE |
Gene ID | |
Swiss Prot | |
Synonyms | PPAR; NR1C1; hPPAR; PPARalpha; PPAR-alpha; PPARα |
Calculated MW | 52kDa |
Observed MW | 52kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver, Mouse kidney |
Cellular location | Nucleus. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens, Gallus gallus, Mus musculus) IF(Mus musculus) RT-PCR(Mus musculus) WB(Mus musculus) IP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6697? Please let us know so that we can cite the reference in this datasheet.