제품 > 항체 > 다중클론항체(pAb)

PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb (A18571)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb (A18571) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb
Catalog No.	A18571
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.The B regulatory subunit might modulate substrate selectivity and catalytic activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human PPP2R1A/PPP2R2A/PPP2R1BPPP2R1A (NP_055040.2).
Sequence	MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSA
Gene ID
Swiss Prot
Synonyms	PPP2R1A/PPP2R2A/PPP2R1B
Calculated MW
Observed MW	55kDa/66kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HepG2, K-562, NIH/3T3, C6, Mouse liver, Mouse lung, Rat brain, Rat testis
Cellular location	cytoplasm, cytosol, dendrite, extracellular exosome, glutamatergic synapse, lateral plasma membrane, microtubule cytoskeleton, mitochondrion, neuron projection, nucleus