Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Immunohistochemistry analysis of PRELID1 in paraffin-embedded human tonsil tissue using PRELID1 Rabbit pAb (A25108) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of PRELID1 in paraffin-embedded human colon carcinoma tissue using PRELID1 Rabbit pAb (A25108) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | PRELID1 Rabbit pAb |
|---|---|
| Catalog No. | A25108 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to a sequence within amino acids 174-219 of human PRELID1(NP_037369.1). |
|---|---|
| Sequence | PSKTLVETAKEAKEKAKETALAATEKAKDLASKAATKKQQQQQQFV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PX19; PRELI; SBBI12; CGI-106 |
| Calculated MW | 25kDa |
| Observed MW | Refer to figures |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Immunohistochemistry Immunofluorescence |
| Positive samples | |
| Cellular location | Mitochondrion |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
