제품 > 항체 > 다중클론항체(pAb)

PRLHR Rabbit pAb (A10479)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using PRLHR antibody (A10479) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	PRLHR Rabbit pAb
Catalog No.	A10479
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable neuropeptide receptor activity. Predicted to be involved in female pregnancy. Predicted to act upstream of or within G protein-coupled receptor signaling pathway; feeding behavior; and hormone metabolic process. Located in cilium. Implicated in hypertension.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRLHR (NP_004239.1).
Sequence	MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV
Gene ID
Swiss Prot
Synonyms	GR3; GPR10; PrRPR
Calculated MW	41kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, U-87MG, Mouse brain
Cellular location	Cell membrane, Multi-pass membrane protein