Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | PRLHR Rabbit pAb |
---|---|
Catalog No. | A10479 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRLHR (NP_004239.1). |
---|---|
Sequence | MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV |
Gene ID | |
Swiss Prot | |
Synonyms | GR3; GPR10; PrRPR |
Calculated MW | 41kDa |
Observed MW | 41kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, U-87MG, Mouse brain |
Cellular location | Cell membrane, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.