제품 > 항체 > 다중클론항체(pAb)

PROKR2 Rabbit pAb (A2960)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PROKR2 antibody (A2960) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	PROKR2 Rabbit pAb
Catalog No.	A2960
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded protein is similar in sequence to GPR73, another G protein-coupled receptor for prokineticins.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human PROKR2 (NP_658986.1).
Sequence	MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL
Gene ID
Swiss Prot
Synonyms	HH3; KAL3; PKR2; GPRg2; GPR73b; GPR73L1; dJ680N4.3
Calculated MW	44kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-251MG, SKOV3, 293T, Mouse thymus
Cellular location	Cell membrane, Multi-pass membrane protein