제품 > 항체 > 다중클론항체(pAb)

PRPF8 Rabbit pAb (A6053)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PRPF8 Rabbit pAb (A6053) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - PRPF8 Rabbit pAb (A6053)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using PRPF8 Rabbit pAb (A6053) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using PRPF8 Rabbit pAb (A6053) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat pancreas using PRPF8 Rabbit pAb (A6053) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PRPF8 Rabbit pAb (A6053)

Immunofluorescence analysis of U-251MG cells using PRPF8 Rabbit pAb (A6053) at dilution of 1:100 (20x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	PRPF8 Rabbit pAb
Catalog No.	A6053
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. This gene is a candidate gene for autosomal dominant retinitis pigmentosa.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRPF8 (NP_006436.3).
Sequence	MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVL
Gene ID
Swiss Prot
Synonyms	PRP8; RP13; HPRP8; PRPC8; SNRNP220; PRPF8
Calculated MW	274kDa
Observed MW	274kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, Jurkat
Cellular location	Nucleus speckle
Customer validation	(MESC, 293T) WB(Mus musculus) IF(Homo sapiens) IHC(Homo sapiens) IP(Homo sapiens)