Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PRPSAP2 Rabbit pAb |
---|---|
Catalog No. | A15711 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 211-252 of human PRPSAP2 (NP_001340030.1). |
---|---|
Sequence | HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKP |
Gene ID | |
Swiss Prot | |
Synonyms | PAP41; PRPSAP2 |
Calculated MW | 41kDa |
Observed MW | 36kDa/41kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T, Mouse testis, Mouse brain, Rat testis, Rat brain |
Cellular location | cytoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.