Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | PRSS21 Rabbit pAb |
---|---|
Catalog No. | A16100 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-220 of human PRSS21 (NP_006790.1). |
---|---|
Sequence | TKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD |
Gene ID | |
Swiss Prot | |
Synonyms | ESP1; ESP-1; TEST1; TESTISIN; PRSS21 |
Calculated MW | 35kDa |
Observed MW | 36kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse testis, Rat testis |
Cellular location | Cell membrane, GPI-anchor, Lipid-anchor |
* For research use only. Not for therapeutic or diagnostic purposes.