제품 > 항체 > 다중클론항체(pAb)

PSMB1 Rabbit pAb (A1043)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using PSMB1 Rabbit pAb (A1043) at 1:3500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - PSMB1 Rabbit pAb (A1043)

Immunofluorescence analysis of C6 cells using PSMB1 antibody (A1043) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using PSMB1 antibody (A1043) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using PSMB1 antibody (A1043) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	PSMB1 Rabbit pAb
Catalog No.	A1043
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-241 of human PSMB1 (NP_002784.1).
Sequence	RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Gene ID
Swiss Prot
Synonyms	HC5; PSC5; PMSB1; NEDMHAL
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7, PC-3, 293T
Cellular location	Cytoplasm, Nucleus