제품 > 항체 > 다중클론항체(pAb)

PSORS1C1 Rabbit pAb (A17841)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using PSORS1C1 Rabbit pAb (A17841) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	PSORS1C1 Rabbit pAb
Catalog No.	A17841
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is one of several genes thought to confer susceptibility to psoriasis and systemic sclerosis, located on chromosome 6 near the major histocompatibility complex (MHC) class I region.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 40-100 of human PSORS1C1 (NP_054787.2).
Sequence	HVNPDRLCHMEPANHFWHAGDLQAMISKEFHLAATQDDCRKGRTQEDILVPSSHPELFASV
Gene ID
Swiss Prot
Synonyms	SEEK1; C6orf16; PSORS1C1
Calculated MW	17kDa
Observed MW	16kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-431, LO2, BxPC-3, K-562
Cellular location