Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Western blot analysis of extracts of various cell lines, using PTPIP51/RMDN3 antibody (A22057) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.
| Product name | PTPIP51/RMDN3 Rabbit mAb |
|---|---|
| Catalog No. | A22057 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC54933 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PTPIP51/RMDN3 (NP_060615.1). |
|---|---|
| Sequence | VSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | RMD3; RMD-3; FAM82C; FAM82A2; ptpip51 |
| Calculated MW | 52kDa |
| Observed MW | 52kDa |
| Reactivity | Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Rat lung |
| Cellular location | Cytoplasm, Mitochondrion membrane, Mitochondrion outer membrane, Nucleus, Single-pass membrane protein, cytoskeleton, spindle, spindle pole |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
