제품 > 항체 > 다중클론항체(pAb)

PURA Rabbit pAb (A9296)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using PURA Rabbit pAb (A9296) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	PURA Rabbit pAb
Catalog No.	A9296
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 203-322 of human PURA (NP_005850.1).
Sequence	AKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQQQEETAAATLLLQGEEEGEED
Gene ID
Swiss Prot
Synonyms	PUR1; MRD31; NEDRIHF; PURALPHA; PUR-ALPHA; PURA
Calculated MW	35kDa
Observed MW	36kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, A-549, HeLa, HepG2, Jurkat
Cellular location	Nucleus
Customer validation	WB(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens)