제품 > 항체 > 단일클론항체(mAb)

PXDN Rabbit mAb (A26777)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PXDN Rabbit mAb (A26777) at 1:15000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Daudi
Exposure time: 45s.

Overview

Product name	PXDN Rabbit mAb
Catalog No.	A26777
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC71453

Background

This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in this gene cause corneal opacification and other ocular anomalies, and also microphthalmia and anterior segment dysgenesis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 431-520 of human PXDN (NP_036425.1).
Sequence	ALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQ
Gene ID
Swiss Prot
Synonyms	PXN; VPO; MG50; PRG2; ASGD7; COPOA; D2S448; D2S448E; hsPxd01
Calculated MW	165kDa
Observed MW	165kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:7700 - 1:30800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HUVEC, U-2 OS, Mouse heart, Rat lung
Cellular location	basement membrane, cell surface, endoplasmic reticulum, extracellular exosome, extracellular region, extracellular space.