Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Pan Cadherin Rabbit pAb |
---|---|
Catalog No. | A18682 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800-882 of human pan-cadherin (NP_004351.1). |
---|---|
Sequence | RPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD |
Gene ID | |
Swiss Prot | |
Synonyms | |
Calculated MW | |
Observed MW | 135kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | PC-3, A-431, Mouse brain, Rat brain |
Cellular location | actin cytoskeleton, adherens junction, apical junction complex, cell junction, cytoplasm, cytoplasmic side of plasma membrane, endosome, extracellular exosome, extracellular region, flotillin complex, glutamatergic synapse, lateral plasma membrane, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network. |
Customer validation | WB(Other) IHC(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18682? Please let us know so that we can cite the reference in this datasheet.