Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Product name | Peroxiredoxin 1/PAG Rabbit pAb |
---|---|
Catalog No. | A16412 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human Peroxiredoxin 1/PAG (NP_001189360.1). |
---|---|
Sequence | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Gene ID | |
Swiss Prot | |
Synonyms | PAG; PAGA; PAGB; PRX1; PRXI; MSP23; NKEFA; TDPX2; NKEF-A; Peroxiredoxin 1/PAG |
Calculated MW | 22kDa |
Observed MW | 22kDa |
Reactivity | Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat liver |
Cellular location | Cytoplasm, Melanosome. |
Customer validation | WB(Rana sylvatica, Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16412? Please let us know so that we can cite the reference in this datasheet.