제품 > 항체 > 다중클론항체(pAb)

Peroxiredoxin 2 (PRDX2) Rabbit pAb (A21814)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Peroxiredoxin 2 (PRDX2) Rabbit pAb (A21814) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Peroxiredoxin 2 (PRDX2) Rabbit pAb (A21814)

Immunofluorescence analysis of NIH/3T3 cells using Peroxiredoxin 2 (PRDX2) Rabbit pAb (A21814) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using Peroxiredoxin 2 (PRDX2) Rabbit pAb (A21814) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Peroxiredoxin 2 (PRDX2) Rabbit pAb
Catalog No.	A21814
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human Peroxiredoxin 2 (PRDX2) (NP_859428.1).
Sequence	MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWYEQGPKREVAAKLTPSGPSSVASWPLLNLWNLRFPIVKIMETLPPKSLRMMTVISI
Gene ID
Swiss Prot
Synonyms	PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a; Peroxiredoxin 2 (PRDX2)
Calculated MW	22kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Hep G2, Mouse brain, Rat brain, Rat spleen, Rat heart
Cellular location	Cytoplasm
Customer validation	IF(Mus musculus)