Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Phospholamban Rabbit mAb |
---|---|
Catalog No. | A23750 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC59796 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-52 of human Phospholamban. (NP_002658.1). |
---|---|
Sequence | MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL |
Gene ID | |
Swiss Prot | |
Synonyms | PLN; CMD1P; CMH18; PLB; phospholamban; Phospholamban |
Calculated MW | 6kDa |
Observed MW | 12kDa/24kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse heart, Rat heart |
Cellular location | endoplasmic reticulum, mitochondrial membrane, mitochondrion, perinuclear region of cytoplasm. |
Customer validation | IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23750? Please let us know so that we can cite the reference in this datasheet.