제품 > 항체 > 단일클론항체(mAb)

Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (A3430)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HT-29 cells, using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of lysates from Mouse lung, using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (A3430)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (A3430)

Immunofluorescence analysis of C6 cells using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb
Catalog No.	A3430
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2028

Background

This gene encodes a phospholipid scramblase family member. The encoded protein is involved in disruption of the asymmetrical distribution of phospholipids between the inner and outer leaflets of the plasma membrane, resulting in externalization of phosphatidylserine. This cell membrane disruption plays an important role in the blood coagulation cascade as well as macrophage clearing of apoptotic cells. The encoded protein has additionally been implicated in gene regulation and interferon-induced antiviral responses.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1).
Sequence	MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE
Gene ID
Swiss Prot
Synonyms	MMTRA1B; Phospholipid Scramblase 1 (PLSCR1)
Calculated MW	35kDa
Observed MW	35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HT-29, Mouse lung
Cellular location	Cell membrane, Nucleus, Cytoplasm, Cytoplasm, perinuclear region