Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Pqbp1 Rabbit pAb |
---|---|
Catalog No. | A18680 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-263 of mouse Pqbp1 (NP_062351.2). |
---|---|
Sequence | EGKDRRHHRREELAPYPKNKKATSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD |
Gene ID | |
Swiss Prot | |
Synonyms | Sfc2; npw38; PQBP-1; Pqbp1 |
Calculated MW | 31kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Rat brain |
Cellular location | centrosome, ciliary base, cilium, cytoplasm, cytoplasmic stress granule, neuronal ribonucleoprotein granule, nuclear body, nuclear speck, nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.