제품 > 항체 > 단일클론항체(mAb)

Prdm9 Rabbit mAb (A20832)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ Hep G2 cells with 1 μg Prdm9 Rabbit mAb (A20832), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Prdm9 in representative gene loci (GAPDH), as shown in figure.

ABclonal:Western blot - Prdm9 Rabbit mAb (A20832)

Western blot analysis of various lysates using Prdm9 Rabbit mAb (A20832) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Rat kidney, using Prdm9 Rabbit mAb (A20832) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Prdm9 Rabbit mAb (A20832)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Prdm9 Rabbit mAb (A20832) at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using Prdm9 Rabbit mAb (A20832) at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	Prdm9 Rabbit mAb
Catalog No.	A20832
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51589

Background

Enables DNA binding activity; histone-lysine N-methyltransferase activity; and protein homodimerization activity. Involved in several processes, including gamete generation; histone lysine methylation; and meiosis I. Acts upstream of or within several processes, including histone methylation; positive regulation of meiotic nuclear division; and positive regulation of transcription by RNA polymerase II. Located in chromatin and nucleus. Is expressed in embryo and head. Orthologous to human PRDM9 (PR/SET domain 9).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3).
Sequence	DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGIKWG
Gene ID
Swiss Prot
Synonyms	Rcr1; Dsbc1; repro7; Meisetz; PRDM9-B; G1-419-29; Prdm9
Calculated MW	97kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. CUT&Tag 10⁵ cells /1 μg
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A549, Mouse testis, Rat testis, Rat kidney
Cellular location	nucleoplasm, nucleus.