제품 > 항체 > 다중클론항체(pAb)

Prdm9 Rabbit pAb (A20428)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Immunofluorescence analysis of mouse testis using Prdm9 Rabbit pAb (A20428) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat testis using Prdm9 Rabbit pAb (A20428) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Prdm9 Rabbit pAb
Catalog No.	A20428
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables DNA binding activity; histone-lysine N-methyltransferase activity; and protein homodimerization activity. Involved in several processes, including gamete generation; histone lysine methylation; and meiosis I. Acts upstream of or within several processes, including histone methylation; positive regulation of meiotic nuclear division; and positive regulation of transcription by RNA polymerase II. Located in chromatin and nucleus. Is expressed in embryo and head. Orthologous to human PRDM9 (PR/SET domain 9).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3).
Sequence	DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGIKWG
Gene ID
Swiss Prot
Synonyms	Rcr1; Dsbc1; repro7; Meisetz; PRDM9-B; G1-419-29
Calculated MW	97kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	nucleoplasm, nucleus